Apiacta, 2001, 36 (1), 12 - 24
Infection and immunity in the honey bee Apis mellifera
by Z. Gliński1, J.
Jarosz2
1 Bee Diseases Research Laboratory, Faculty of Veterinary Medicine,
Akademicka 12, 20-033 Lublin, Poland
2 Department of Insect Pathology, Marie Curie-Sk³odowska University,
Akademicka 19, 20-033 Lublin, Poland
Introduction
The honey bee is subject during its life to a nearly continual challenge by
different saprophytic and pathogenic microorganisms (bacteria, viruses),
protozoan and metazoan parasites (larvae of Senotainia tricuspis, Mermis sp.)
and parasitic mites (Acarapis woodi, Varroa jacobsoni). In response to
infection and injury a variety of immune processes have evolved to suppress
invaders that have succeeded in reaching the haemocoel (Dunn, 1986). The
anatomical and physiological barriers formed by the cuticle, midgut and tracheal
system play a crucial role in protecting the insect against the penetration of
microbial intruders into the haemolymph (Gliński and Jarosz, 1995a). When the
outer protective barriers are broken the invader encounters the internal immune
responses active in the coelomic cavity of the bee (Gliński and Jarosz,
1995b,c).
Haemocytes, the major cellular components in the immune system are involved in
the cell-mediated immune reactions (Salt, 1970) while humoral defense is
attributed to the activity of soluble protective factors, both innate and
inducible of insect haemolymph (Boman and Hultmark, 1987). The ability to
discriminate between self and non-self is the first prerequisite that generate
the immune defense phenomena (Ratcliffe and Götz, 1990). The recognition and
attachment events that initiate cellular defense response in innate system are
regulated by humoral and by membrane-bound molecules that discriminate self
versus nonself. Bacterial LPS or peptidoglycan molecules and mannose, galactose
or glucan residues in the case of fungi, hemolin and lectins are the pattern
recognition molecules (Schmidt et al., 1993).
In addition, the honey bee as a social insect has developed mechanisms that
efficiently protect both the individual and the whole colony against a great
number of microbial pathogens (Gliński and Jarosz, 1994). The environment
polluting agents and pesticides can undoubtedly impair the non-self response
system and protective defense of the bee against pathogens, parasites and
predators.
Antiviral
protection
Up to date more than 15 distinct viruses have been
characterized from honey bees. Most of them persist as inapparent infections,
however, the latent viruses can be induced to multiply to readily detectable
levels under stress conditions. All known viral diseases of honey bees are
specific for only one stage in the life cycle: acute paralysis virus (APV),
chronic paralysis virus (CPV), cloudy wing virus (CWV) attack adults whereas
sacbrood virus (SBV), black queen cell virus (BQCV) are restricted to larval
stages (Allen and Ball, 1996).
The most common route of infection with bee viruses is the ingestion of intact
virions by feeding insects. The ingested viral particles may infect the
epithelial cells of the midgut or pass through the gut wall to enter susceptible
target cells in the insect body. Bee viruses are polytrophic because they infect
most, if not all, tissues of the host. The most important role in virus-host
relation is played by a specificity of the virus to the insect, the portal of
entry for virions to the host body and the efficacy of the bee defense
mechanisms. The bee viruses like other insect viruses, have evolved mechanisms
for avoidance or depression of the insect host responses. These mechanisms allow
them to survive for a long periods in their hosts and cause latent infections (Ratcliffe
et al., 1985).
A number of the nonimmunological factors modify and control virus replication
and the outcome of viral infections. Commonly known protecting the bee against
viruses are the thresholds present in the midgut and formed by the biochemical
environment of the gut juice, the peritrophic membrane and the midgut epithelium.
In most cases, the peritrophic membrane limits the spread of infection because
of its impermeable or hardly permeable barrier to viral particles (Smith et al.,
1993). Only viruses that passed the peritrophic membrane may infect the gut
epithelium. They could trespass the epithelial lining of the midgut, infect
coelomic cavity, cause a viraemia and then infect body tissues. A prerequisite
for infection is adsorption of virions to the specific receptors on the surface
of susceptible cell. One cause of inhibition of viral replication is the
production of interferons released from virus infected cells within a few hours
after viral invasion. Insect interferons are glycoproteins (20-34 kDa) stable to
heat and to extremes of pH.
It can be hypothesized that in bees, like in mammals, interferon could act by
entering infected cells and depressing their DNA, so that produce translation
inhibitory protein. This protein, can in turn, block the takeover of cell
ribosomes by viral RNA, and hence inhibits virus replication.
The another factor that controls viral infections is lack of specific receptors
at the plasma membrane to bind of ligands. The binding of ligands to receptors
stimulates cells to change shape, endocytose, proliferation or modulation of
cell functions. Once a viral nucleoprotein penetrates the plasma or vesicular
membrane it must make its way to the site in the cell where it will replicate.
Within the infected cell, replication of bee viruses occurs entirely within the
cytoplasm. Serologically related viruses, sometimes by unrelated or defective
viruses may block the viral receptors on the susceptible cells. The blocking of
viral receptors on sensitive cells is an effective mechanism of antiviral
defense.
Viral infections induce unspecific cell defense reactions such as phagocytosis
and nodule formation. Phagocytosis of virions develops in early and late stages
of infection when viruses are liberated into the haemolymph from damaged cells.
Phagocytosis and nodule formation is not always effective in prevention and
control of viral diseases. The final result is both the recovery of the bee host
due to the efficacy of the defense mechanisms or the viral invader prevails and
the host is killed. A small number of viruses or viruses of a low virulence
infecting the insect are killed by haemocytes whereas heavy infections or
virulent strains can replicate and kill a specific types of haemocytes involved
in antiviral defensive reactions.
Finally, many microbial parasites have evolved mechanisms for avoidance or
depression of the insect host response. These mechanisms allow parasites to
survive for long periods in the bee organism, which act as a source of new
infection within a bee colony. Obviously, the neurons in the thoracic and
abdominal ganglia protect replicating bee paralysis viruses from phagocytosis
and other haemocytic defense reactions.
Bacterial
infections and immunity
Bacteria associated with bees are widely distributed in soil, water, and air,
stored bee food, surface of plants and skin of other living creatures. In most
infections bacteria invade the bee body cavity through the intestines with
ingested bacteria contaminated food. Bacteria may also infect the bee body via
spiracles or with the aid of the piercing or chewing mouthparts of predators and
external parasites, for example via cuticular abrasions caused by a stenophagous
mite Varroa jacobsoni (Gliński and Jarosz, 1992). Any break of the
cuticle or the alimentary canal is a portal of entry for bacterial invaders.
The honey bee larvae can develop the American foulbrood (Paenibacillus larvae
larvae), European foulbrood (Mellissococcus pluton) and the powdery scale
disease (Bacillus pulvifaciens) whereas in adult bees septicaemias result mostly
from Pseudomonas aeruginosa, Hafnia alvei and Enterococcus faecalis infections.
Saprophytic and plant pathogenic bacteria may also accidentally induce the fatal
septicaemia after invading the haemocoel.
Bee body coverings and the biochemical environment of the midgut juice by
bacteriostatic or bactericidal action effectively restrict the development of
most infections caused by bacterial saprophytes (Jarosz, 1993; 1995). If the
bacteria succeed in reaching the haemocoel through mechanically injured or
enzymatically damaged anatomical protective barriers, they generate the internal
immune responses in body cavity.
The bee has an open circulatory system and numerous haemocytes are contained in
its haemolymph. Prohaemocytes, plasmatocytes, granular cells, cystocytes,
sphaerula cells and enocytoids are the cells that comprise the bee haemocyte
population (Gupta, 1991). Commonly known haemocyte- mediated defense reactions
of bees consist of phagocytosis, encapsulation, cytotoxicity, secretion of
materials to damage foreign organisms (humoral encapsulation) or to modulate
immunocyte functions. Haemocytes are able to recognize self and non-self. At
least three possible factors may act as non self-recognition molecules in bees,
that is the components of the prophenoloxidase cascade, lectins and chemokines.
The prophenoloxidase activating system (proPO) consists of a cascade of enzymes
and associated factors such as various plasma receptors, serine proteases and
inhibitors (Söderhäll and Smith, 1986). The multifunctional proPO cascade is
comparable to the vertebrate complement system in a number of ways. Both systems
generate opsonic intermediates that assist in the initial recognition and
attachment phases of phagocytosis.
Much interest has recently been generated by the observation that the pPO is
involved in immune recognition and cellular communication. This system itself
can react to foreign materials and be converted into its active form by
microbial products. The granular cell type may contain not only lectins but also
components of the proPO system. This cell type rapidly degranulates in contact
with non self materials to release the non self recognition molecules.
The occurrence of lectins in haemolymph of bees is scarcely documented. They
have in insects a dual function, in defense and in development. The lectins
enhance recognition and phagocytosis by insect haemocytes and they have ascribed
roles in nutrition and development. They probably are involved in tissue
reorganization and cell adhesion (Olafsen, 1986).
Hemokines, a group a small secreted proteins, function as important regulators
of the immune system by inducing haemocytes to migration and by modulation
haemocyte-antisome interactions (Chadwick and Aston, 1991).
The haemocytes can engulf and destroy smaller foreign objects such as bacteria
or fungal spores, but larger parasites, bacterial clumps or fungal hyphae, are
encapsulated by several haemocytes and then removed from circulation.
The cellular immune responses have been shown to be accompanied by changes both
in the number of circulating haemocytes and the relative proportions of
different haemocyte types in the blood. Generally, the infection mobilizes
sessile haemocytes to migrate and increases a percentage of round plasmatocytes
(Bahadur, 1993). Predominant cells involved in phagocytosis are plasmatocytes,
followed by granular cells (Sharma et al., 1986). Although the cells involved in
the process of phagocytosis in the bee are well recognized the mechanisms or the
factors involved in this process and the role they play are not yet clearly
understood. The engulfed bacteria are digested in phagolysosome by released
hydrolytic enzymes, primarily lysozyme, alkaline phosphatase, ribonucleases and
phospholipases.
Relatively little is known about oxygen-dependent microbial killing mechanism in
insects. Superoxide anions have been detected in several lepidopterans and there
is evidence that lipophorin is involved in production of these molecules. (Arakawa
et al., 1996). Nitric oxide synthetase (NOS) has been detected in insect fat
body and Malpighian tubules. The fat body NOS is induced by bacterial LPS. The
generated nitric acid acts as signaling/messenger molecule or as a toxic
antimicrobial agent (Mims et al., 1995). The role of factors such as proPO,
melanins and recruitment factors cannot be excluded in phagocytic process. They
all may increase the number of collisions between phagocytes and foreign bodies
and mobilize sessile haemocytes. In some instances, however, the captured
bacteria may even multiply within the phagocytes, causing their death. Release
bacteria then multiply in the insect blood and the bee perishes due to a fatal
septicaemia.
Cellular encapsulation of large foreign invaders is a common phenomenon of
cell-mediated immune reaction protecting the insect host. Components of the
proPo system could function as signaling molecules to promote encapsulation. A
400 kDa complex consisting in part of of prophenoloxidase, phenoloxidase, and an
interleukin 1 was isolated from Manduca sexta haemolymph (Beck et al., 1996).
The invader is enclosed in several layers of cells and the capsule-like so
formed melanizes and strictly isolates the parasite from circulation. The
primary stimulus initiating the encapsulation may originate from either foreign
substance present on the surface of an invader or metabolites and waste products
released by the parasite. The granular cells that contact and recognize the
foreign body as a non-self structure degenerate to release sticky proteins that
attract the plasmatocytes. Melanization is not a regular process of cellular
encapsulation. Only living organisms induce both encapsulation and melanization.
The melanization of the capsule depends on the proPO activating system that
kills the microorganisms and parasites, isolating them from the rest of the body
in the hard and impermeable capsule. Death of larvae and embryos of parasites,
adolescent protozoans and nematodes may result from asphyxiation or the
accumulation of toxic wastes in the capsule. Encapsulated parasites may die
through the toxic effects of quinones that contribute to melanization (Vey and
Götz, 1975).
Nodule formation is a phenomenon in response to both animate and inanimate
substances that cannot be removed from circulation by phagocytosis. In this
cellular reaction, the haemocytes loaded with bacteria are entrapped by a
coagulum that is produced by the degranulating granular cells and then centrally
melanized. A sheet of blood cells surrounds the entrapped invaders in that
coagulum in the center. The fate of nodulated bacteria depends on their
virulence. In general, bacterial saprophytes are quickly killed within melanized
nodules while pathogenic bacteria may subsequently liberate from the nodules
into the haemolymph (Ratcliffe and Rowley, 1979).
Cell-free immune reactions involve synthesis and release of several
antibacterial immune proteins, some capable of killing both Gram negative and
Gram positive bacteria. The expression of this multicomponent humoral immune
system requires the de novo synthesis of a specific immune mRNA in the fat body
and response peptides and small protein synthesis with broad antibacterial
activity (Boman and Hultmark, 1987; Jarosz, 1979).
The bee responds to fungal infections by altering immunocompetent cell motility.
Haemocytes have been shown to migrate towards fungal spores and hyphae. Such
migratory responses may help to explain the selective depletion of insect cells
from circulation that is often evident during cell-mediated immune reactions
directed against parasitic fungus.
Among the great majority of immune mediators in insects which have been infected
with bacteria, lysozyme, apidaecins, abaecin and hymenoptaecin have been found
to exist in the honey bee (Gliński and Jarosz, 1995c). The bee lysozyme is a
relatively small molecule (about 15 kDa), representing a group of true lysozymes
shared characteristics with the chicken type lysozyme. The concentration of
lysozyme in larval honey bees and in adults ranges from 5.0 µg to 25.0 µg/ml,
and in pupae from 5.0-10.0 µg/ml of haemolymph. Bacterial infection or
artificial inoculation of bacterial saprophytes increase the concentration of
lysozyme in haemolymph of bee larvae even to more than 1300 µg /ml whereas in
flying worker bees to not more than 40.0 µg/ml. It is hypothesized that in brood
lacking of the inducible apidaecin-family antibacterial response peptides the
enhanced potency of lysozyme reduced the risk of infection of preimaginal stages
by saprophytic bacteria (Gliński and Jarosz, 1993). The peptidoglycan fragments
of Gram positive bacteria released by the lytic action of lysozyme act as a very
potent elicitors of antibacterial peptides such as apidaecins. In several cases
lysozyme acts as a synergistic with the smaller cationic peptides (Bang et al.,
1997)
The apidaecins represent a family of inducible, non-helical, small (about 2 kDa)
proline-rich antibacterial peptides of activity mostly against Gram- negative
bacteria (Casteels et al., 1989). They are the most prominent components of the
honey bee inducible cell-free defense against bacterial invaders. Apidaecins of
the honey bee consist of four closely-related peptides (Ia, Ib, II and III)
composed of 18 amino acid residues each (Fig. 1). Biologically active isoforms
appear in haemolymph of the adult bee whereas the inactive precursor molecules -
proapidaecins exist in the blood of the last instar larvae. Conversion of the
apidaecin precursors into active peptides could occur through a stepwise
cleavage of dipeptides ending either a proline or an alanine. Structural
analysis suggests that apidaecins contain both a constant region responsible for
potency and a variable region which dictates the antibacterial spectrum (Casteels-Josson
et. al., 1993).
| Proapidaecin Ia/b EAKPEAKP | GNNRPVYIPQPRPPHPR I/L |
| Apidaecin Ia | GNNRPVYIPQPRPPHPRI |
| Apidaecin Ib | GNNRPVYIPQPRPPHPRL |
| Apidaecin II | GNNRPIYIPQPRPPHPRL |
| Apididaecin III | GNNRPVYISQPRPPHPRI |
| E Glutamic acid | G Glycine | I Isoleucine |
| A Alanine | N Asparagine | Q Glutamine |
| K Lysine | R Arginine | H Histidine |
| P Proline | V Valine | Y Tyrosine |
| L Leucine |
Fig. 1 - Sequences for the precursor of apidaecins Ia and Ib and amino acid sequence of apidaecins Ia, Ib, III and III of the honey bee, Apis mellifera
A sharp increase of apidaecin transcript levels occurr 4-6 hours after
infection, followed by a steady rise of several more hours. Peak concentration
in the haemolymph is within 36 hour post-infection and then the concentration of
the apidaecin compounds declines in bee blood gradually for the 3-4 next days.
It is now known that the mode of action of the apidaecins is to attack bacterial
cell membrane by the ionophoretic action, they form voltage-dependent ion
channels causing leakage and cell death. This activity is non-specific and so
apidaecins have a fairly broad range of activity. They are highly active against
Gram negative bacteria, but show only a weak activity against Gram positive
bacteria. The spectra of activity for all isoforms of apidaecins are very
similar, and seems to be bacteriostatic rather than bactericidal.
The activity of apidaecins is directed against bacteria present commonly in the
bee environment (Table 1).
It can be suggested that the marked activity of apidaecins directed against
enteric bacteria, plant-associated and phytopathogenic bacteria developed in the
bee as a defense mechanism active against the bacterial species contaminating
plant and water sources visited by flying worker bees. The presence of inactive
precursor of apidaecins in the haemolymph of brood may reflect differences in
the immune status of the larval and adult stages of the honey bee. The risk of
brood infection by bacteria contaminating the worker bees is reduced by factors
of antibacterial activity of royal jelly, honey and pollen. Larva responds to
bacterial infection by increasing the level of lysozyme in the haemolymph (Gliński
and Jarosz, 1995b).
Table I - Antibacterial activity of apidaecin Ia, Ib and II Apis mellifera (Casteels et al., 1989)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
A second antibacterial protein that was originally discovered from the honey bee is abaecin (Casteels et al., 1990). It is a large inducible, proline-rich, -helical peptide (about 4.0 kDa) of antibacterial activity. Unlike the apidaecins, the range of activity of abaecin for bacteria is quite narrow and confined to a limited number of both Gram negative and Gram positive bacteria. The molecule of abaecin contains 10 proline residues but not cysteine (Fig. 2). Abaecin reveals striking similarities to apidaecins in Apis mellifera and diptericins in flies. Matching patterns of prolines and hydrophobic amino acids are present in the first 18 residues of each of the three immune peptides.
| Apis YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
Fig.2 - Complete amino acid sequence of abaecin in the honey bee, Apis mellifera
Although the abaecin is induced upon microbial infection of the
bee body cavity, its contribution to antibacterial defence of the bee remains
still unclear. The mode of action of the abaecin is to alter the permeability of
the outer membrane of the target bacterium. It is thought that the result of
this action by abaecin allows improved access to the cell wall for lysozyme and
to the cytoplasmic membrane for the apidaecins. Most probably abaecin, like
apidaecins, represents an advanced level of internal cell-free antibacterial
immunity of the bee. They both represent the highest level of adaptation of
Apis mellifera response system to destroy plant pathogenic and enteric
bacteria present ubiquitously in the bee living niche.
In the clarifying the honey bee haemolymph from bacteria participates
hymenoptaecin (Casteels et al., 1993), apart from apidaecin-family peptides and
abaecin. Hymenoptaecin is a glycine-rich peptide having 93 amino acid residues
(about 10 kDa) with bactericidal activity for Gram negative and Gram positive
bacteria. This inducible peptide requires higher doses of bacteria for induction
and appears in the haemolymph at later time post-infection and at lower
concentration than apidaecins.
Immune
defenses against pathogenic fungi
The best known protective mechanisms active in the honey bee to fungal
infection, notably in chalkbrood and stonebrood, are in the anatomical structure
of the bee body (Barr and Shope, 1975; Orihel, 1975). The impermeable and hard
cuticle, the biochemical environment of the midgut juice, peritrophic membrane
of the midgut and tracheal system form together a mechanical and physiological
barrier effectively protecting the bee` s body cavity against fungal invasion. A
relatively low humidity in the tracheae is an important factor in restricting
germination of spores and growth of fungus in the bee respiratory tract. Waxes
and unsaturated fatty acids impregnating the cuticle or present on its surface
have a potent antifungal action. Competition for food between gut bacteria and
fungi could efficiently eliminate massive doses of fungal spores from the gut.
Nevertheless, chitinase producing moulds and yeasts can actively penetrate the
cuticular lining of the body and then infect the haemocoel. The cuticle damaged
mechanically or enzymatically by growing hyphae also allow bacteria to enter
body cavity and develop fatal septicaemias.
Non-degradable fungal materials are encapsulated by a large mass of haemocytes
that serve as a barrier between the haemocoel and the object. Bee haemocytes may
also directly kill fungal spores and other small foreign molecules in phagocytic
process (GÖtz, 1986). These cellular immune reactions have been shown to be
accompanied by changes both in the number of circulating haemocytes and in the
relative proportions of different haemocyte types in the blood (Hink, 1970). The
infection of the haemocoel initiates a premature differentiation of haemocytes
and their migration towards chemotactic stimulus. Phagocytosis predominates when
the body cavity is exposed to small numbers of bacteria or fungal spores.
Encapsulation is the most effective haemocyte-mediated immune response in
protection of insect haemocoel in fungal infections. This cell-mediated reaction
consists of the formation of a capsule-like envelope around foreign objects with
a diameter more than 10 m that cannot be phagocytized by a single cell. The
capsule is formed by attaching blood cells, mainly granular cells and
plasmatocytes. The granulocytes release chaemotactic factors which attract the
plasmatocytes to form the outer layer of the capsule around the encapsulated
fungus. The role of the phenoloxidase activating system cannot be excluded in
phagocytosis and melanization of encapsulated insect pathogenic fungi.
Neither lysozyme nor the haemolymph response proteins seem to inhibit
or destroy spores or fungal mycelia in the invaded bee. The honey bee generate
several groups of humoral immune factors to resist bacterial infections. The
apidaecin-family peptides, abaecin and hymenoptaecin, the most prominent
components of the honey bee inducible humoral defense, are inactive entirely to
fungal invaders.
Protective
mechanisms in protozoan invasions
The protozoans attack the epithelial cells of the midgut (Nosema apis,
Leidyana apis) or Malpighian tubules (Malpighamoeba mellificae) of
the adults only (de Graaf et al., 1993; 1994). Pathological changes in
epithelial cells and derangement of digestive processes by N. apis, both of
which led to malnutrition and premature death of the invaded bees. In the
parasitized individuals, desquamation of pathologically altered epithelial cells
loaded with parasites, and their removal with feces, lowers the possibility of
massive invasion of other parts of gut epithelium. Scars that develop at the
site of removed dead epithelial cells, and newly developing epithelium, prevent
the migration of the bee microflora from the gut into the body cavity.
Variations in resistance could be assigned to the activity of chymozin in the
honey bee ventriculus since this enzyme by improving the development of the
peritrophic membrane prevents N. apis spores for coming into close contact with
the epithelial gut cells.
When spores invade the bee body cavity, cell-mediated defense reactions seem to
play a crucial role in the control of N. apis invasion. Very often, haemocytes
aggregate around the parasite and are active in phagocytosis and nodule
formation. Cysts and spores of parasites, like vegetative forms, can be
effectively encapsulated. The effectiveness of haemocytic reactions in protozoan
invasions is high but the parasites become increasingly difficult to eliminate
as invasion progresses. Bacterial infections associated with the mechanical
destruction of host cells by the developing protozoan accelerate the death of
bees.
The protozoan Malpighamoeba mellificae attacks the epithelium of the Malpighian
tubules, which usually become swollen and degenerated. The greatly distended
tubules occasionally rupture and elicit a massive inflammatory response. Since
the number of parasitic cysts produced in the body of the bee is low, massive
lethal invasions of bees are not frequent. The anatomical protective barriers of
the gut limit the destructive action of the parasite.
Mechanisms
of resistance to the mite Varroa jacobsoni
Of about one hundred species of mites which live in or around honey bee colonies
in various parts of the world, three mite species are dangerous to the honey
bee: Varroa jacobsoni, Acarapis woodi and Tropilaelaps clareae.
The pathogenic effects of V. jacobsoni invasion closely related to the number of
parasites and their developmental stage are attributable to the mechanical
injuries, depletion of haemolymph proteins and to toxic effects of the parasite.
Furthermore, the parasitic mite, induces latent viral infections (Allen and
Ball, 1996), and transmits bacterial and fungal infections to the recipient bee
host (Gliński and Jarosz, 1992). It is possible that the parasite impairs the
internal defense reactions of the bee and brood (Gliński and Jarosz, 1984;
1988a).
At least, the five mechanisms that minimize the impact of V. jacobsoni on honey
bees have so far been discovered: grooming behaviour, removal of mite infested
brood, rapid development time, unattractive brood for the mite and infertility
of mites on some bees brood (Boecking, 1994).
In the Asian bee Apis cerana exists behavioural tolerance to V.
jacobsoni. A. cerana grooms herself, removing the mite, while the European
bee does not or at most grooms very little. After A. cerana caught a mite, it
would kill it by biting and crushing it, then taking it out of the hive.
Moreover, successful reproduction of V. jacobsoni on Apis cerana is
limited by seasonal occurring drone brood and is lacking in worker brood (Rath,
1991; Rosenkranz et al., 1993). The infested drones become weakened by the
parasitic mites, are not able to uncapping their cells, and in consequence they
die together with mites inside uncapped cells. The bees which show the hygienic
behaviour uncap and remove bee pupae that contain a Varroa mite.
Behavioural tolerance of Apis mellifera to V. jacobsoni was found
in Africanized and European honey bees from Brasil, Tunisia and Uruguay (Ritter
et al., 1990). In Varroa-tolerant A. mellifera colonies there is a reduced
fertility of V. jacobsoni in worker brood compared to the successful
reproduction of the mite in drone brood.
One of the reasons why V. jacobsoni is not a problem with the Asian bee is the
short period of time the pupae is capped which does not permit a long enough
time for the mite to develop. Also differences in the susceptibility to V.
jacobsoni in A. mellifera carnica compared to A. mellifera capensis were found
and A. mellifera ligustica compared to A. mellifera monticola hybrids. A shorter
development time in bees is a time factor limiting the reproduction rate of V.
jacobsoni because it would prevent the mite from completing its development
(Wilde and Koeniger, 1992). Selection for a post-capping period, that is even a
few hours shorter, may decrease the development of V. jacobsoni infestations.
The grooming behaviour towards phoretic V. jacobsoni mites seems to exist to a
lower degree in A. mellifera compared to A. cerana. It is evident that A.
mellifera is able to kill V. jacobsoni mites (Ruttner and HÄnel, 1992). The
effect of this defence behaviour on the development of the colony infestation is
till unknown. A. mellifera from Europe and North America stocks also remove V.
jacobsoni from capped brood cells. However, in some cases the caps of mite
infested brood are opened and then closed again without eliminating of
parasitized brood. Mite removal may limit the Varroa population because immature
mites are killed, female mites are killed and those that survive removal process
cannot reproduce. A. mellifera removes not only mite infested drone brood but
also worker brood which is in contrast to the behaviour of A. cerana (Boecking,
1994).
Resistance
mechanisms and factors of the honey bee as a social insect
Analysis of the immune responses in the bees revealed the well developed system
through which the individual bee acquires a special type of immunity. This
system is based on cell-mediated reactions and a number of innate and inducible
immune proteins, some of them potent antibacterial proteins like lysozyme and
apidaecin-family peptides. Apart from internal immune defenses, other mechanisms
of the colony resistance to invaders are known. They include the antibacterial
activity of honey, nectar and pollen, secretions of the honey bee exocrine
glands, antimicrobial activity of propolis. A specific behaviour resistance
protects the be colony from bacterial and fungal infections.
The antimicrobial activity of honey, nectar and pollen is an important factor in
the colony that inhibits the development of many saprophytic bacteria and fungi
in stored food, and that could destroy some pathogenic microorganisms (Burgett,
1978). The acidity, osmotic pressure and production and accumulation of hydrogen
peroxide are responsible for this effect in honey and nectar (White and Subers,
1963). Honey as a hyperosmotic medium may kill many living cells, except those
of osmophilic fungi and bacteria.
Secretions from honey bee exocrine glands contain biologically significant
components. The hypopharyngeal gland secretions of young workers contain
proteins to be bacteriostatic and bactericidal to a wide range of bacterial
species (Rose and Briggs, 1969). At least two bacterial inhibitors are
identified in royal jelly: 10-hydroxy-2-decenoic acid and glucose oxidase. It
can also inhibit or delay the growth of many fungi, for example A. apis.
Propolis, that is a highly complex mixture of waxes, resins, balsams, oils and a
small amount of pollen forms a part of antimicrobial defense of the bee colony.
Flavanones together with flavones, caffeic acid and its esters are considered to
be responsible for antibacterial action of propolis (Greeneway et al., 1990). It
is quite possible that fungi of plant origin and from animal sources, polluting
environment and contaminating pollen sources and water gathered by bees are
inhibited by biologically active compounds of propolis.
Hygienic behaviour can be characterized by the rapid detection of sick and dead
brood by worker bees, removal of dead insects from the colony, and the thorough
cleaning of the cell of honey comb. Worker bees groom their own bodies and those
of other bees, maintain the hygiene of the nest and remove debris from the hive.
This hygienic activity is important in the resistance to chalkbrood and stone
brood. The adults remove the mummified larvae using their mandibles and carry
the larvae away from the nest. Bees that have no means of removing the
pathogenic fungi from the gut and the body hair subsequently reinfect
susceptible larvae when feeding them or pass on infectious fungal spores to
other adults of the colony (Southwick, 1994). Resistance is supported by an
ability of some worker bees to filter ingested spores and mycelial fragments
from the proventriculus. Inhibitors in the glandular-produced brood food are
strong antibacterial and antifungal agents.
There are at least two mechanisms of behavioural resistance, both are genetic in
nature. Hygienic behaviour is believed to be controlled by two recessive genes,
one for uncapping diseased brood, and one for the removal of mummy (Taber,
1992). The expression of hygienic behaviour depends on the strength of the bee
colony. When colony size is reduced by removing frames of brood and associated
bees, hygienic activity is depressed in hygienic colonies but there is no effect
in non-hygienic colonies. The expression of hygienic behaviour is also altered
by adding hygienic or non-hygienic bees to colony, and by the colony
composition. Taber (1992) has stated that all bees with hygienic behaviour
tested to chalkbrood were resistant. Southwick (1994), however, has suggested
that there is not straightforward correlation between hygienic behaviour and
resistance to chalkbrood. The chalkbrood infected colonies showed a weak
correlation with hygienic behaviour.
References
Allen M., Ball B., The incidence and world distribution of honeybee viruses. Bee World 77 (1996), 141-162
Arakawa T., Kato Y., Hattori M., Yamakawa M., Lipophorin: a carrier for lipids in insects participates in superoxide production in the haemolymph plasma. Insect Biochem. Molec. Biol. 26 (1996), 403-409
Bahadur J., Haemocytes and their population. In: Insect Immunity. (Ed. Pathak J.P.N.), Kluwer Academic Publ. Dordrecht, Boston, London, 1993, pp. 15-32
Bang I.S., Son S.Y., Yoe M.S., Hinnavin I, an antibacterial peptide from cabbage butterfly, Artogeia rapae. Moll. Cells. 7 (1997), 509-513
Barr A.R., Ahope R.E., The invertebrate gut as a barrier to invading parasites. In: Invertebrate Immunity. (Eds. Maramorosh K., Shope R. E.). Academic Press; New York, USA, 1975, pp 113-114
Beck G., Cardinale S., Wang L., Reiner M., Sugumaran M., Characterization of a defense complex consisting of interleukin 1 and phenol oxidase from the haemolymph of the tobacco hornworm, Manduca sexta. J. Biol. Chem. 271 (1996), 11035-11038
Boecking O., The removal behavior of Apis mellifera L. towards mite-infested brood cells as a defense mechanism against the ectoparasitic mite Varroa jacobsoni Oud. PhD Thesis, Rheinische-Friedrich-Wilhelms-Universität, Bonn, 1994
Boman H.G., Hultmark D., Cell-free immunity in insects. Ann. Rev. Immunol. 41 (1987), 103-126
Burgett D. M., Antibiotic systems in honey, nectar and pollen. In: Honey Bee Pests, Predators, and Diseases. (Ed. Morse R. A.). Comstock Publ. Ass. Ithaca and London, 1978, pp 297-308
Casteels P.R., Ampe C., Jacobs F.J., Vaeck M., Tempst P., Apidaecins: antibacterial peptides from honeybees. EMBO J. 8 (1989), 2387- 2391
Casteels P.R., Ampe C., Riviere L., Van Damme J., Elicone C., Fleming M., Jacobs F.J., Tempst P., Isolation and characterization of abaecin, a major antibacterial response peptide in the honeybee (Apis mellifera). EMBO. J. 187 (1990), 381-386
Casteels P., Ampe C., Jacobs F.J., Tempst P., Functional and chemical characterisation of hymenoptaecin, an antibacterial peptide that is infection-inducible in the honeybee (Apis mellifera). J. Biol. Chem. 268 (1993), 7044-7054
Casteels-Josson K., Capaci T., Casteels Pr., Tempst P., Apidaecin multipeptide precursor structure: a putative mechanisms for amplification of the insect antibacterial response. EMBO. J. 12 (1993): 1569-1578
Chadwick J.M., Aston W. P., Antibacterial immunity in Lepidoptera. In: Immunology of Insects and other Arthropods (Ed. Gupta A.P.), CRC Press, Boca Raton, FL, 1991, pp. 347-370
De Graaf D. C., Masschelein G., Vandergeynst F., De Brabander H. F., Jacobs F. J., In vitro germination of Nosema apis (Microspora: Nosematidae) spores and its effect on their - trehalose/d-glucose ratio. J. Inver. Pathol. 62 (1993), 220-225
De Graaf D. C., Raes H., Saabe G., De Rycke P. H., Jacobs F. J., Early development of Nosema apis (Microspora: Nosematidae) in the midgut epithelium of the honeybee (Apis mellifera). J. Invert. Pathol. 63 (1994), 74-81
Dunn P. E., Biochemical aspects of insect immunology. Ann. Rev. Entomol. 31 (1986), 321-339
Götz P., Encapsulation in Arthropods. In: Immunity in Invertebrates (Eds. Brehelin M., Boemare N.), Springer Verlag, Berlin, Heidelberg, 1986, pp 153-170
Glinski Z., Jarosz J., Alterations in haemolymph proteins of drone honey bee larvae parasitized by Varroa jacobsoni. Apidologie 15 (1984), 329-338
Glinski Z., Jarosz J., Deleterious effects of Varroa jacobsoni on the honey bee. Apiacta 23 (1988a) 42-52
Glinski Z., Jarosz J., Varoa jacobsoni as a carrier of bacterial infections to a recipient bee host. Apidologie 23 (1992), 25-31
Gliński Z., Jarosz J., Further evidence for cell-free immunity in the honeybee, Apis mellifera. Apiacta 28 (1993), 69-78
Gliński Z., Jarosz J., Defensive strategies of the honeybee (Apis mellifera L.) as a social insect. Apiacta 29 (1994), 107-120
Glinski Z., Jarosz J., Mechanical and biochemical defences of honey bees. Bee World 76 (1995a), 110-118
Glinski Z., Jarosz J., Cellular and humoral defences in honey bees. Bee World 76 (1995b), 195-205
Gliński Z., Jarosz J., Apidaecins and abaecin, the effector substances of inducible immune responses of the honeybee. Pol. J. Immunol./Immunologia Polska 20 (1995c), 137-148
Greeneway W., Scaysbroock T., Whatley F. R., The composition and plant origins of propolis: a report work at Oxford. Bee World 71 (1990): 107-118
Gupta A.P., Ed. Immunology of Insects and other Arthropods. CRC Press, Boca Raton, FL., 1991
Hink W. F., Immunity in insects. Transpl. Proc. 2 (1970), 233-235
Jarosz J., Simultaneous induction of protective immunity and selective synthesis of haemolymph lysozyme protein in larvae of Galleria mellonella. Biol Zentrblt 98 (1979): 459-471
Jarosz J., Induction kinetics of immune antibacterial proteins in pupae of Galleria mellonella and Pieris brassicae. Com. Biochem. Physiol 106B (1993), 415-421
Jarosz J., Haemolymph immune proteins protect the insect body cavity from invading bacteria. Comp. Bioch. Physiol. 111C (1995), 213-220
Mims C., Dimmock N., Nash A., Stephen J., Mim`s Pathogenesis of Infectious Disease. IV ed. Academic Press, London, 1995
Olafsen J. A., Invertebrate lectins: Biochemical heterogeneity as possible key to their biological function. In Immunity in Invertebrates. (Ed. Brechelin M.). Springer Verlag, Berlin, Heidelberg, New York. Tokyo, 1986, pp 94-111
Orihel T. C., The peritrophic membrane: its role as a barrier to infection of the arthropod host. In: Invertebrate Immunity. (Eds. Maramorosch K., Shope R. E.) Academic Press, New York, 1975, pp 67-73
Ratcliffe N. A., Götz P., Functional studies on insect haemocytes including non-self recognition. Res Immunol 141 (1990), 919-923
Ratcliffe N., Rowley A.F., Role of hemocytes in defense against biological agents. In: Insect Hemocytes, Development, Forms, Functions, and Techniques. (Ed. Gupta A.P.), Cambridge Univ. Press, N.Y, 1979, pp. 331-414
Ratcliffe N.A., Rowley A.F., Fitzgerald S.W., Rhodes C.P., Invertebrate immunity: basic concepts and recent advances. Int. Rev. Cytol. 97 (1985), 183-350
Rath W., Investigations of the parasitic mites, Varroa jacobsoni Oud. and Tropilaelaps clareae Delfinado and Baker and their hosts Apis cerana Fabr., Apis dorsata Fabr., and Apis mellifera L. PhD Thesis, Rheinische-Friedrich-Wilhelms-Universität, Bonn, 1991
Ritter W., Michael P., Bartholdi A., Schwendemann A., Development of tolerance to Varroa jacobsoni in bee colonies in Tunisia. In: Proc. Recent Res. On Bee Pathology. (Eds. Ritter W., Van Laere O., Jacobs F.J., De Wael L.). Apimondia. 1990, pp. 54-59
Rose R. I., Briggs J. D., Resistance to American foulbrood in honey bees. IX. Effects of honey-bee larval food on the growth and viability of Bacillus larvae. J. Invertebr. Pathol. 13 (1969), 74-80
Rosenkranz P., Tewarson N. C., Sigh A., Engels W., Differential hygienic behaviour towards Varroa jacobsoni in capped worker brood of Apis cerana depends on allien scent adhering to the mites. J. Apicult. Res. 32 (1993), 89-102
Ruttner F., Hänel H., Active defense against Varroa mites in Carniolan strains of honey bees. Apidologie 23 (1992), 173-187
Söderhäll K., Smith V. J., The prophenoloxidase activating system: the biochemistry of its activation and role in arthropod cellular immunity with special reference to crustaceans. In: Immunity in Invertebrates. (Eds. Brehelin M., Boemare N.). Springer Verlag, Berlin, Heidelberg, 1986, pp 208-223
Salt G., The cellular defense reactions of insects. Monogr in Exper Biol 16, Cambridge Univ. Press, 1970
Schmidt O.C., Faye I., Lindstrom-Dinnetz I., Sun S.C., Specific immune recognition of insect hemolin. Dev. Comp. Immunol. 17 (1993), 195-200
Sharma P.R., Tikku K., Saxena B.P., An electron microscopic study of normal haemocytes of Poecilocerus pictus (Fab.) and their response to injected yeast cells. Insect Sci. Applic. 7 (1986), 85-91
Southwick E.E., Hygienic behavior and disease resistance in honey bees. Amer. Bee J. 134 (1994), 751-752
Taber S., Studies on chalkbrood disease. Amer. Bee J. 132 (1992), 327-328
Vey A., Götz P., Humoral encapsulation in Diptera (Insecta): Comparative studies in vitro. Parasitology 70 (1975), 77-86
White J.W., Subers M.H., Studies on honey inhibine. 2. A chemical assay. J. Apicult. Res. 2 (1963), 93-100
Wilde J., Koeniger N., Selektion auf Verkürzung der Zellverdecklungsdauer (ZVD) der Arbeiterinnenbrut von Apis mellifera carnica. Annls UMCS, s. DD. 47 (1992), 133-139
| Realization: Gilles
RATIA Last update: 08/12/00 APISERVICES - Copyright © 1995-2003 |
Top of the page |